PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G209500.1.p
Common NameGLYMA_07G209500, LOC100812420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 413aa    MW: 45667.6 Da    PI: 8.3764
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G209500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-32270325156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a+++LGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Glyma.07G209500.1.p 270 KQRRCWSPELHRRFVNALQKLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 325
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.461267327IPR017930Myb domain
SuperFamilySSF466895.73E-18267328IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-29268328IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-27270325IPR006447Myb domain, plants
PfamPF002494.2E-8272323IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MGSVAAEELN LDLRSSFVPK TITDFLRHLS ANNNHPATLR DFLSRLEDEL RKIHAFKREL  60
PLSMLLLNDA ISVLKVESQK CCRVARDSPP VLEEFIPLKK ELGDQSEEEE ENDDDKDDNE  120
CRDKRNWMSS VQLWNNNTTT TTTNNNNNAS DRKQLLHKLQ TKKSEEGQSV AEDPFQTCSN  180
RNGGRRAFMP FSRYSSSSSS VPVTTVGLGA ASKEEKEESV RNRLSLLTPS VKEGCGSRGS  240
RSSSNRAVSS SPPTAQPGLR ATSLQQTARK QRRCWSPELH RRFVNALQKL GGSQAATPKQ  300
IRELMQVDGL TNDEVKSHLQ KYRLHTRRVP AASSNQPVVV LGGLWMSQDQ YNDSSKVSSS  360
GSGSPQSPLH LAAGSRGGTS PTEGDSIEDD EDARSESYSW KSHMNKPGKV DV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.338870.0cotyledon| epicotyl| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0963771e-143BT096377.1 Soybean clone JCVI-FLGm-15D9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529382.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
TrEMBLI1KLX00.0I1KLX0_SOYBN; Uncharacterized protein
STRINGGLYMA07G33130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-50G2-like family protein